PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa19g027060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-PHD
Protein Properties Length: 731aa    MW: 80471.6 Da    PI: 4.5058
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa19g027060.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox37.93.1e-12624668953
                     HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
        Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                     +  +++L   F++n+yp+++++e LAk+l++t  qV++WF+ rR+
  Csa19g027060.1 624 DPKTQRLYISFQENQYPDKATKESLAKELQMTIMQVSNWFKHRRY 668
                     567899999***********************************7 PP

2PHD39.71.1e-13269324151
                     SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ Cg+     +++++lCdg C++ fH++Cl+++l+++++p +  +wlC+ C++k
  Csa19g027060.1 269 FCAKCGSkdLSVDNDIILCDGfCDRGFHQYCLEPPLRKDDIPPDdeSWLCPGCDCK 324
                     699***955445********88*******************99999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579031.53E-13260324IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.103.1E-13266323IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001611.208267324IPR019787Zinc finger, PHD-finger
SMARTSM002491.4E-9269322IPR001965Zinc finger, PHD-type
PfamPF006283.5E-11269324IPR019787Zinc finger, PHD-finger
CDDcd155045.17E-27269321No hitNo description
PROSITE patternPS013590270321IPR019786Zinc finger, PHD-type, conserved site
SMARTSM003891.9E-9615677IPR001356Homeobox domain
SuperFamilySSF466891.28E-11621668IPR009057Homeodomain-like
PROSITE profilePS5007112.05623673IPR001356Homeobox domain
CDDcd000861.02E-11623668No hitNo description
PfamPF000461.1E-9624668IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-12625682IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 731 aa     Download sequence    Send to blast
MNGAAAFKRV TRSSASGLKQ INVDSGGEVK DPTVDNVSEQ GNASVPLKPS EAGSQMPNDA  60
NGVRGNGKGK EVQTPTPQTG KKRSNTKTKF SGSYRELVIG LPCRGQFEIQ RSRSSKSSKR  120
LGGGGERNVL FSSHKSAQRS KDAAAGSSSA AANNTPVGSI PRKRKKTTKK GEVREDDEYT  180
RIKKKLRYLL KRINYEQNLI DAYSLEGWRG SSLEKLRPEK ELERATKEIL QRKVKIRDLF  240
QHLDTLCAEG SLPESLFDSH GAISSDDIFC AKCGSKDLSV DNDIILCDGF CDRGFHQYCL  300
EPPLRKDDIP PDDESWLCPG CDCKDDSLDL LNDSLGTKLS VSDSWEKIFP EAAAALAGGD  360
QNLNCDLPSD DSDDEEYDPD GLNDNENDED NSEDSDESEN EDGSSDESDF TSASDEMIES  420
FKEGKDIMAD IMALPSDDSE DDDYDPEAPT RDEDEIQESS NSDCTSDSED IETSFKGNES  480
NQQDEATPLE DPGRKKPQLP YDSISESDAV LDDGLAGVPR RRNVERLDYK KLYDEEYENV  540
PSSSSDDDDY KTAIMGKEDS ESGDEGDTVS LKQSANAEDH TSKKPRRKSK RADEKDTLEV  600
PQQGPGENGC SGEKSSSIAY KQTDPKTQRL YISFQENQYP DKATKESLAK ELQMTIMQVS  660
NWFKHRRYVK SKPVVSEEAV EKSKTGKEGE CGRSVAGSSK QTSMETESVA GNKSVASEST  720
NPGSRKRRRR *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1161165RKRKK
2180186RIKKKLR
3582590KKPRRKSKR
4724728RKRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1171050.0AK117105.1 Arabidopsis thaliana At3g19510 mRNA for putative homeobox protein HAT3.1, complete cds, clone: RAFL16-64-G01.
GenBankBT0059650.0BT005965.1 Arabidopsis thaliana At3g19510 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010487898.10.0PREDICTED: homeobox protein HAT3.1
RefseqXP_010487897.10.0PREDICTED: homeobox protein HAT3.1
SwissprotQ049960.0HAT31_ARATH; Homeobox protein HAT3.1
TrEMBLR0G2870.0R0G287_9BRAS; Uncharacterized protein
STRINGAT3G19510.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72702543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.10.0Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain